PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA1515
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family CO-like
Protein Properties Length: 438aa    MW: 48926.4 Da    PI: 5.1365
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA1515genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box28.63e-091760340
                  zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                              +r C+ +  k+++++C  ++ +lC+ C ++ H+       H++v
  Tp57577_TGAC_v2_mRNA1515 17 ARACDSCITKRARWYCAADDAFLCQACDSSVHSAnslarrHERV 60
                              578*****************************657788888876 PP

2CCT682.5e-23383426144
                       CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                               Rea+++RY+eKr+tR+F+KkirYe+RK +Ae+RpR+KGrFvk+a
  Tp57577_TGAC_v2_mRNA1515 383 REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA 426
                               9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003365.4E-101562IPR000315B-box-type zinc finger
PROSITE profilePS5011910.9361562IPR000315B-box-type zinc finger
PfamPF006436.8E-81760IPR000315B-box-type zinc finger
CDDcd000213.09E-101862No hitNo description
PROSITE profilePS5101716.083383425IPR010402CCT domain
PfamPF062037.4E-18383425IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0016020Cellular Componentmembrane
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 438 aa     Download sequence    Send to blast
MSCSSKKAAN AVGGKTARAC DSCITKRARW YCAADDAFLC QACDSSVHSA NSLARRHERV  60
RLKTASYKST GGDDEFNNSG PFSGFTKKAR TPRQGKNKSS SSNEPARNNN NNPFHLVPEM  120
GFDEVNSLSH DENEEQLLYR VPIFDPFVAE LCSTSPPSVG SSEGGLGTIT IASDTFAPDT  180
KNIRSENRSG SNNYEMESFH GLLPSDIELA EFAADVESLL GRGLENECIG MEELGLIDTK  240
NEKDREWECI GKVKEESEES HEVVEVDNIE MMGKESSFEL NFDYDESHET CEEVKGKVGL  300
DIEQNENNNC NKGKRKISLQ LDYDAIIIAW DSQKCPWTNG DKPNLDADET LLDCMGTYGT  360
EVNYPYGEFG GYGYNPVMVD GGREARVSRY REKRRTRLFS KKIRYEVRKL NAEKRPRMKG  420
RFVKRASFAV PTFPLLK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1393409RRTRLFSKKIRYEVRKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1373112e-32BT137311.1 Medicago truncatula clone JCVI-FLMt-21J5 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013470181.10.0zinc finger constans-like protein
TrEMBLA0A072VQB90.0A0A072VQB9_MEDTR; Uncharacterized protein
STRINGGLYMA10G42090.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14733392
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25440.11e-97B-box type zinc finger protein with CCT domain